Review



phlip-1  (Synpeptide Co Ltd)

 
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 90
      Buy from Supplier

    Structured Review

    Synpeptide Co Ltd phlip-1
    Phlip 1, supplied by Synpeptide Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/phlip-1/phlip+1/pm40247709-218-3-28
    Average 90 stars, based on 1 article reviews
    phlip-1 - by Bioz Stars, 2026-10
    90/100 stars

    Images

    Related Articles

    other:

    Article Title: Protonation-Regulated Membrane-Insertion Dynamics of pH Low-Insertion Peptide: Metastable Molecular Conformations and Their Transitions
    Article Snippet: The variants, including pHLIP-1 (AEQNPIYWARYADWLFTTGLLLLDLALLVDADEGTK(TAMRA)), pHLIP-2 (AEQNPIYWARYADWLFTTPLLLLDLALLVDGTK(TAMRA)), and pHLIP-3 (AEQNPIYWARYADWLFTTPLLLLDLALLVGTK(TAMRA)) were also synthesized by Synpeptide Co., Ltd. (Nanjing), with a purity over 95%.

    Article Title: Protonation-Regulated Membrane-Insertion Dynamics of pH Low-Insertion Peptide: Metastable Molecular Conformations and Their Transitions.
    Article Snippet: The variants, including pHLIP-1 (AEQNPIYWARYADWLFTTGLLLLDLALLVDADEGTK( T A M R A ) ) , p H L I P - 2 (AEQNPIYWARYADWLFTTPLLLLDLALLVDGTK(TAMRA)), and pHLIP-3 (AEQNPIYWARYADWLFTTPLLLLDLALLVGTK(TAMRA)) were also synthesized by Synpeptide Co., Ltd. (Nanjing), with a purity over 95%.



    Similar Products

    phlip-1  (Synpeptide Co Ltd)
    90
    Synpeptide Co Ltd phlip-1
    Phlip 1, supplied by Synpeptide Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/phlip-1/phlip+1/pm40247709-218-3-28
    Average 90 stars, based on 1 article reviews
    phlip-1 - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    phlip-beclin 1 gene sequence  (Sangon Biotech)
    90
    Sangon Biotech phlip-beclin 1 gene sequence
    Phlip Beclin 1 Gene Sequence, supplied by Sangon Biotech, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/phlip-1/phlip+beclin+1+gene+sequence/pm29359549-60-8-15
    Average 90 stars, based on 1 article reviews
    phlip-beclin 1 gene sequence - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier

    Image Search Results